Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Olfactory receptor-like protein OLF4

This Recombinant Dog Olfactory receptor-like protein OLF4 spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein OLF4

UniProt

Q95157

Expression Region

1-309

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELENDTRIPEFLLLGFSEEPKLQPFLFGLFLSMYLVTILGNLLLILAVSSDSHLHTPMY FFLANLSFVDICFTCTTIPKMLVNIQTQRKVITYESCIIQMYFFELFAGIDNFLLTVMAY DRYMAICYPLHYMVIMNPQLCSLLLLVSWIMSALHSLLQTLMVLRLSFCTHFQIPHFFCE LNQMIQLACSDTFLNNMMLYFAAILLGVAPLVGVLYSYFKIVSSIRGISSAHSKYKAFST CASHLSVVSLFYCTSLGVYLSSAAPQSTHTSSVASVMYTVVTPMLNPFIYSLRNKDIKGA LNVFFRGKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF594 conjugate, 0.1mg/mL
BNC941761-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (4C6-H8), 1mg/mL
BNUM0866-50 1x 50 µL

TNF alpha (4C6-H8), 1mg/mL

Sign In for Pricing
View Details
Man a(1,6) [Man a(1,3)] Man a-O-BSA Colloidal Gold Conjugate, 1mL 15nm
CCG-1014-15 1 mL

Man a(1,6) [Man a(1,3)] Man a-O-BSA Colloidal Gold Conjugate, 1mL 15nm

Sign In for Pricing
View Details
ZAP70 Recombinant Rabbit monoclonal Antibody
HA723344 100 µL

ZAP70 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
LILRB2 Human Gene Knockout Kit (CRISPR)
KN207770LP 1 Kit

LILRB2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Valproic Acid-d6 Beta-D-Glucuronide
TRC-V094762-1MG 1 mg

Valproic Acid-d6 Beta-D-Glucuronide

Sign In for Pricing
View Details