Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8B4 (OR8B4)

This Recombinant Human Olfactory receptor 8B4 (OR8B4) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 8B4, Olfactory receptor OR11-315

UniProt

Q96RC9

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLRNSSSVTEFILVGLSEQPELQLPLFLLFLGIYVFTVVGNLGLITLIGINPSLHTPMY FFLFNLSFIDLCYSCVFTPKMLNDFVSESIISYVGCMTQLFFFCFFVNSECYVLVSMAYD RYVAICNPLLYMVTMSPRVCFLLMFGSYVVGFAGAMAHTGSMLRLTFCDSNVIDHYLCDV LPLLQLSCTSTHVSELVFFIVVGVITMLSSISIVISYALILSNILCIPSAEGRSKAFSTW GSHIIAVALFFGSGTFTYLTTSFPGSMNHGRFASVFYTNVVPMLNPSIYSLRNKDDKLAL GKTLKRVLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(Oxybis (4,1-phenylene) ) bis (dimethylsilanol)
OR1001916-01 5 g

(Oxybis (4,1-phenylene) ) bis (dimethylsilanol)

Sign In for Pricing
View Details
(Oxybis (4,1-phenylene) ) bis (dimethylsilanol)
OR1001916-02 25 g

(Oxybis (4,1-phenylene) ) bis (dimethylsilanol)

Sign In for Pricing
View Details
(Oxybis (4,1-phenylene) ) bis (dimethylsilanol)
OR1001916-03 100 g

(Oxybis (4,1-phenylene) ) bis (dimethylsilanol)

Sign In for Pricing
View Details
Anti-SMAD2 Antibody Picoband® (monoclonal, 3C4), Carrier-free
M00090-3-carrier-free 100 µg/Vial

Anti-SMAD2 Antibody Picoband® (monoclonal, 3C4), Carrier-free

Sign In for Pricing
View Details
Sheep Complement C1q like protein 2 (C1QL2) ELISA kit
GTR10440627 96 Well

Sheep Complement C1q like protein 2 (C1QL2) ELISA kit

Sign In for Pricing
View Details
5-Aminoallyl 2'-deoxyuridine 5'-triphosphate sodium salt - 100mM aqueous solution
NA46883-01 1 mg

5-Aminoallyl 2'-deoxyuridine 5'-triphosphate sodium salt - 100mM aqueous solution

Sign In for Pricing
View Details