Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8B4 (OR8B4)

This Recombinant Human Olfactory receptor 8B4 (OR8B4) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 8B4, Olfactory receptor OR11-315

UniProt

Q96RC9

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLRNSSSVTEFILVGLSEQPELQLPLFLLFLGIYVFTVVGNLGLITLIGINPSLHTPMY FFLFNLSFIDLCYSCVFTPKMLNDFVSESIISYVGCMTQLFFFCFFVNSECYVLVSMAYD RYVAICNPLLYMVTMSPRVCFLLMFGSYVVGFAGAMAHTGSMLRLTFCDSNVIDHYLCDV LPLLQLSCTSTHVSELVFFIVVGVITMLSSISIVISYALILSNILCIPSAEGRSKAFSTW GSHIIAVALFFGSGTFTYLTTSFPGSMNHGRFASVFYTNVVPMLNPSIYSLRNKDDKLAL GKTLKRVLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Maftivimab Biosimilar - Research Grade
ICH5666-20mg 20 mg

Maftivimab Biosimilar - Research Grade

Sign In for Pricing
View Details
IGHG3 Protein (Native, Mouse)
P525571 100 µg

IGHG3 Protein (Native, Mouse)

Sign In for Pricing
View Details
ANXA2 peptide
orb216913-01 1 mg

ANXA2 peptide

Sign In for Pricing
View Details
ANXA2 peptide
orb216913-02 5 mg

ANXA2 peptide

Sign In for Pricing
View Details
(+)-Glaucarubinone
MBS5791590 Inquire

(+)-Glaucarubinone

Sign In for Pricing
View Details
Rabbit Monoclonal IgG4 Antibody (SR2850)
NBP3-27717-100ul 100 µL

Rabbit Monoclonal IgG4 Antibody (SR2850)

Sign In for Pricing
View Details