Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2AP1 (OR2AP1)

This Recombinant Human Olfactory receptor 2AP1 (OR2AP1) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 2AP1, Olfactory receptor OR12-9

UniProt

Q8NGE2

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNKTVLTEFILLGLTDVPELQVAVFTFLFLAYLLSILGNLTILILTLLDSHLQTPMYFF LRNFSFLEISFTNIFIPRVLISITTGNKSISFAGCFTQYFFAMFLGATEFYLLAAMSYDR YVAICKPLHYTTIMSSRICIQLIFCSWLGGLMAIIPTITLMSQQDFCASNRLNHYFCDYE PLLELSCSDTSLIEKVVFLVASVTLVVTLVLVILSYAFIIKTILKLPSAQQRTKAFSTCS SHMIVISLSYGSCMFMYINPSAKEGDTFNKGVALLITSVAPLLNPFIYTLRNQQVKQPFK DMVKKLLNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUT3 Human Over-expression Lysate
orb1344246 100 µg

FUT3 Human Over-expression Lysate

Sign In for Pricing
View Details
PRRX1 sgRNA CRISPR Lentivector set (Human)
K1732401 3x 1.0 µg

PRRX1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
MBD6 Antibody Blocking peptide
orb1452187 500 µg

MBD6 Antibody Blocking peptide

Sign In for Pricing
View Details
ARPM1 (ACTRT3) (NM_032487) Human Over-expression Lysate
LY410114 100 µg

ARPM1 (ACTRT3) (NM_032487) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse CXCL3/DCIP-1
5568-CA-025 25 µg

Recombinant Mouse CXCL3/DCIP-1

Sign In for Pricing
View Details
STAU1 Protein Vector (Human) (pPM-C-HA)
45703021 500 ng

STAU1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details