Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2AP1 (OR2AP1)

This Recombinant Human Olfactory receptor 2AP1 (OR2AP1) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 2AP1, Olfactory receptor OR12-9

UniProt

Q8NGE2

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNKTVLTEFILLGLTDVPELQVAVFTFLFLAYLLSILGNLTILILTLLDSHLQTPMYFF LRNFSFLEISFTNIFIPRVLISITTGNKSISFAGCFTQYFFAMFLGATEFYLLAAMSYDR YVAICKPLHYTTIMSSRICIQLIFCSWLGGLMAIIPTITLMSQQDFCASNRLNHYFCDYE PLLELSCSDTSLIEKVVFLVASVTLVVTLVLVILSYAFIIKTILKLPSAQQRTKAFSTCS SHMIVISLSYGSCMFMYINPSAKEGDTFNKGVALLITSVAPLLNPFIYTLRNQQVKQPFK DMVKKLLNL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLYCD CRISPR Activation Plasmid (h)
sc-411738-ACT 20 µg

MLYCD CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Ggn (NM_182694) Mouse Tagged ORF Clone
MR212535 10 µg

Ggn (NM_182694) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mmu-miR-872-3p miRNA Agomir
orb1918430-01 5 nmol

Mmu-miR-872-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-872-3p miRNA Agomir
orb1918430-02 10 nmol

Mmu-miR-872-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-872-3p miRNA Agomir
orb1918430-03 20 nmol

Mmu-miR-872-3p miRNA Agomir

Sign In for Pricing
View Details
Mouse Monoclonal SPR Antibody (OTI4F5) [Alexa Fluor 405]
NBP2-74344AF405 0.1 mL

Mouse Monoclonal SPR Antibody (OTI4F5) [Alexa Fluor 405]

Sign In for Pricing
View Details