Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Taste receptor type 2 member 105 (Tas2r105)

This Recombinant Rat Taste receptor type 2 member 105 (Tas2r105) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 105, T2R105, Taste receptor type 2 member 9, T2R9

UniProt

Q9JKT5

Expression Region

1-309

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSAAEGILLSIATVEAGLGVLGNTFIALVNCMDWAKNKKLSKIGFLLFGLATSRIFIVW ILILDAYAKLFFPGKYLSKSLTEIISCIWMTVNHMTVWFATSLSIFYFLKIANFSHYIFL WLKRRTDKVFAFLLWCLLISWAISFSFTVKVMKSNPKNHGNRTSGTHWEKREFTSNYVLI NIGVISLLIMTLTACFLLIISLWKHSRQMQSNVSGFRDLNTEAHVKAIKFLISFIILFIL YFIGVAVEIICMFIPENKLLFIFGLTTASVYPCCHSVILILTNSQLKQAFVKVLEGLKFS ENGKDLRAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-100 1x 100 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
BNC400040-500 1x 500 µL

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD2 (LFA2/600), CF594 conjugate, 0.1mg/mL
BNC940600-500 1x 500 µL

CD2 (LFA2/600), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (KRT17/778), CF405S conjugate, 0.1mg/mL
BNC040778-500 1x 500 µL

Cytokeratin 17 (KRT17/778), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GCDFP-15 (Gross Cystic Disease Fluid Protein 15) (Breast Marker) (PIP/1571), CF640R conjugate, 0.1mg/mL
BNC401571-500 1x 500 µL

GCDFP-15 (Gross Cystic Disease Fluid Protein 15) (Breast Marker) (PIP/1571), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details