Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Taste receptor type 2 member 31 (TAS2R31)

This Recombinant Human Taste receptor type 2 member 31 (TAS2R31) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 31, T2R31, Taste receptor type 2 member 44, T2R44, Taste receptor type 2 member 53, T2R53

UniProt

P59538

Expression Region

1-309

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTFIPIIFSSVVVVLFVIGNFANGFIALVNSIERVKRQKISFADQILTALAVSRVGLLW VLLLNWYSTVFNPAFYSVEVRTTAYNVWAVTGHFSNWLATSLSIFYLLKIANFSNLIFLH LKRRVKSVILVMLLGPLLFLACQLFVINMKEIVRTKEYEGNLTWKIKLRSAVYLSDATVT TLGNLVPFTLTLLCFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVIFFLLLCAV YFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILIWGNKKLKQTFLSVLRQVRYW VKGEKPSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-500 1x 500 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
BNC741003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (KRTL/1077), CF647 conjugate, 0.1mg/mL
BNC471077-100 1x 100 µL

Cytokeratin, LMW (KRTL/1077), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF594 conjugate, 0.1mg/mL
BNC942550-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CGA414 + CGA/777 + CGA/798), CF568 conjugate, 0.1mg/mL
BNC681060-100 1x 100 µL

Chromogranin A (CGA414 + CGA/777 + CGA/798), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 (CD30/412), CF740 conjugate, 0.1mg/mL
BNC740412-500 1x 500 µL

CD30 (CD30/412), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details