Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 7A17 (OR7A17)

This Recombinant Human Olfactory receptor 7A17 (OR7A17) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 7A17

UniProt

O14581

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPENDTGISEFVLLGLSEEPELQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMY FFLSNLSFADICFISTTIPKMLINIQTQSRVITYAGCITQMCFFVLFGGLDSLLLAVMAY DRFVAICHPLHYTVIMNPRLCGLLVLASWMIAALNSLSQSLMVLWLSFCTDLEIPHFFCE LNQVIHLACSDTFLNDMGMYFAAGLLAGGPLVGILCSYSKIVSSIRAISSAQGKYKAFST CASHLSVVSLFCCTGLGVYLTSAATHNSHTSATASVMYTVATPMLNPFIYSLRNKDIKRA LKMSFRGKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ileum
CS624741 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details
Mouse Aqp1 activation kit by CRISPRa
GA200250 1 Kit

Mouse Aqp1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human γ-Synuclein/SNCG Protein
PKSH033274-01 10 µg

Recombinant Human γ-Synuclein/SNCG Protein

Sign In for Pricing
View Details
Recombinant Human γ-Synuclein/SNCG Protein
PKSH033274-02 50 µg

Recombinant Human γ-Synuclein/SNCG Protein

Sign In for Pricing
View Details
2-(2-Hydroxyphenyl)-4,5-dihydro-1,3-thiazole-4-carboxylic Acid
TRC-H947113-50MG 50 mg

2-(2-Hydroxyphenyl)-4,5-dihydro-1,3-thiazole-4-carboxylic Acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS704411 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details