Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 7A10 (OR7A10)

This Recombinant Human Olfactory receptor 7A10 (OR7A10) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 7A10, OST027, Olfactory receptor OR19-18

UniProt

O76100

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSWNNTIILEFLLLGISEEPELQAFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMY FFLSNLSFVDICFVSTTVPKMLVNIQTHNKVITYAGCITQMCFFLLFVGLDNFLLTVMAY DRFVAICHPLHYMVIMNPQLCGLLVLASWIMSVLNSMLQSLMVLPLPFCTHMEIPHFFCE INQVVHLACSDTFLNDIVMYFAVALLGGGPLTGILYSYSKIVSSIRAISSAQGKYKAFST CASHLSVVSLFYGTCLGVYLSSAATHNSHTGAAASVMYTVVTPMLNPFIYSLRNKHIKGA MKTFFRGKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgG, H&L (TRITC) discontinued
I1903-51A 500 µg

IgG, H&L (TRITC) discontinued

Sign In for Pricing
View Details
Rabbit Monoclonal Factor VIII Antibody (402)
NBP2-90255-100ul 100 µL

Rabbit Monoclonal Factor VIII Antibody (402)

Sign In for Pricing
View Details
Pesticide Std Fenamiphos 1000ug/mL in Acetone - 1ML
REPET137 1 mL

Pesticide Std Fenamiphos 1000ug/mL in Acetone - 1ML

Sign In for Pricing
View Details
SHP1 activator 1
HY-168929-01 5 mg

SHP1 activator 1

Sign In for Pricing
View Details
SHP1 activator 1
HY-168929-02 10 mg

SHP1 activator 1

Sign In for Pricing
View Details
SHP1 activator 1
HY-168929-03 25 mg

SHP1 activator 1

Sign In for Pricing
View Details