Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 7A10 (OR7A10)

This Recombinant Human Olfactory receptor 7A10 (OR7A10) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 7A10, OST027, Olfactory receptor OR19-18

UniProt

O76100

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSWNNTIILEFLLLGISEEPELQAFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMY FFLSNLSFVDICFVSTTVPKMLVNIQTHNKVITYAGCITQMCFFLLFVGLDNFLLTVMAY DRFVAICHPLHYMVIMNPQLCGLLVLASWIMSVLNSMLQSLMVLPLPFCTHMEIPHFFCE INQVVHLACSDTFLNDIVMYFAVALLGGGPLTGILYSYSKIVSSIRAISSAQGKYKAFST CASHLSVVSLFYGTCLGVYLSSAATHNSHTGAAASVMYTVVTPMLNPFIYSLRNKHIKGA MKTFFRGKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYT 19 Polyclonal Antibody, Cy7 Conjugated
bs-10633R-Cy7 100 µL

CYT 19 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
COL4A3BP (Collagen Type IV alpha-3-binding Protein, Ceramide Transfer Protein, hCERT, Goodpasture Antigen-binding Protein, GPBP, START Domain-containing Protein 11, StARD11, StAR-related Lipid Transfer Protein 11, CERT, STARD11)
125185 100 µg

COL4A3BP (Collagen Type IV alpha-3-binding Protein, Ceramide Transfer Protein, hCERT, Goodpasture Antigen-binding Protein, GPBP, START Domain-containing Protein 11, StARD11, StAR-related Lipid Transfer Protein 11, CERT, STARD11)

Sign In for Pricing
View Details
UBC9 antibody (biotin)
60R-1284 100 ug

UBC9 antibody (biotin)

Sign In for Pricing
View Details
Polyclonal Cathepsin G Antibody
AMM05696G 0.1ml

Polyclonal Cathepsin G Antibody

Sign In for Pricing
View Details
ZNF213 (NM_004220) Human Tagged ORF Clone
RC203547 10 µg

ZNF213 (NM_004220) Human Tagged ORF Clone

Sign In for Pricing
View Details
ViPrimePLUS Corynebacterium urealyticum qPCR Test Kit
VECC036 1 Kit

ViPrimePLUS Corynebacterium urealyticum qPCR Test Kit

Sign In for Pricing
View Details