Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Protein RTM1 (RTM1)

This Recombinant Saccharomyces cerevisiae Protein RTM1 (RTM1) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Protein RTM1

UniProt

P40113

Expression Region

1-309

Origin

Saccharomyces cerevisiae (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNDSSGSEWELYRYTPSKGAAIALTVLFIVTTLIYSLQVVWDARKASKPEVDNPFDTPV DKCESITAISLGENYKKLTVRSTFSAFIPLFFGCIMEIVGYIARAVSSSNTKEIAPYVIQ AVLLLIAPALYAATIYMLFGRLLHVMRCESLMIVSSRFGTSFFVFGDVVSFCLQAAGGGL MATVNGRTTGSNLITAGLVIQIVFFGVFIINEFRFSYSVARVCPFYRHISKKWWFLNLTL MLSSILIMVRSIVRLVEFVEGYDGFIISHEYFIYVFDAVPMLLAAIVFIVGSFFGNIFTT ITECQSLKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Di-n-butyl Phthalate-d22
TRC-D429496-2MG 2 mg

Di-n-butyl Phthalate-d22

Sign In for Pricing
View Details
CD45RB (DF-B1), CF568 conjugate, 0.1mg/mL
BNC681066-100 1x 100 µL

CD45RB (DF-B1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF640R conjugate, 0.1mg/mL
BNC401564-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Heptyl Undecyl Phthalate
TRC-H285605-25MG 25 mg

Heptyl Undecyl Phthalate

Sign In for Pricing
View Details
CYPIVF11 (CYP4F11) Mouse Monoclonal Antibody [Clone ID: F21 P6 F5]
AM05375PU-N 200 µg

CYPIVF11 (CYP4F11) Mouse Monoclonal Antibody [Clone ID: F21 P6 F5]

Sign In for Pricing
View Details
P4HA1 (NM_001017962) Human Over-expression Lysate
LC422765 20 µg

P4HA1 (NM_001017962) Human Over-expression Lysate

Sign In for Pricing
View Details