Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Protein RTM1 (RTM1)

This Recombinant Saccharomyces cerevisiae Protein RTM1 (RTM1) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Protein RTM1

UniProt

P40113

Expression Region

1-309

Origin

Saccharomyces cerevisiae (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNDSSGSEWELYRYTPSKGAAIALTVLFIVTTLIYSLQVVWDARKASKPEVDNPFDTPV DKCESITAISLGENYKKLTVRSTFSAFIPLFFGCIMEIVGYIARAVSSSNTKEIAPYVIQ AVLLLIAPALYAATIYMLFGRLLHVMRCESLMIVSSRFGTSFFVFGDVVSFCLQAAGGGL MATVNGRTTGSNLITAGLVIQIVFFGVFIINEFRFSYSVARVCPFYRHISKKWWFLNLTL MLSSILIMVRSIVRLVEFVEGYDGFIISHEYFIYVFDAVPMLLAAIVFIVGSFFGNIFTT ITECQSLKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Microwave Digester BMWD-106
BMWD-106 Each

Microwave Digester BMWD-106

Sign In for Pricing
View Details
TIMM50 (NM_001001563) Human Over-expression Lysate
LY424383 100 µg

TIMM50 (NM_001001563) Human Over-expression Lysate

Sign In for Pricing
View Details
Bovine Alpha-1-Acid Glycoprotein (a1AGP) ELISA Kit
RDR-a1AGP-b-01 96 Tests

Bovine Alpha-1-Acid Glycoprotein (a1AGP) ELISA Kit

Sign In for Pricing
View Details
Bovine Alpha-1-Acid Glycoprotein (a1AGP) ELISA Kit
RDR-a1AGP-b-02 48 Tests

Bovine Alpha-1-Acid Glycoprotein (a1AGP) ELISA Kit

Sign In for Pricing
View Details
Human ZFAND2B activation kit by CRISPRa
GA115123 1 Kit

Human ZFAND2B activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Testis
CS505821 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details