Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Protein RTM1 (RTM1)

This Recombinant Saccharomyces cerevisiae Protein RTM1 (RTM1) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Protein RTM1

UniProt

P40113

Expression Region

1-309

Origin

Saccharomyces cerevisiae (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNDSSGSEWELYRYTPSKGAAIALTVLFIVTTLIYSLQVVWDARKASKPEVDNPFDTPV DKCESITAISLGENYKKLTVRSTFSAFIPLFFGCIMEIVGYIARAVSSSNTKEIAPYVIQ AVLLLIAPALYAATIYMLFGRLLHVMRCESLMIVSSRFGTSFFVFGDVVSFCLQAAGGGL MATVNGRTTGSNLITAGLVIQIVFFGVFIINEFRFSYSVARVCPFYRHISKKWWFLNLTL MLSSILIMVRSIVRLVEFVEGYDGFIISHEYFIYVFDAVPMLLAAIVFIVGSFFGNIFTT ITECQSLKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Biphenylyl diphenyl phosphate
TRC-B522613-500MG 500 mg

2-Biphenylyl diphenyl phosphate

Sign In for Pricing
View Details
SPANXN4 (NM_001009613) Human Over-expression Lysate
LC422927 20 µg

SPANXN4 (NM_001009613) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant COX IV Antibody
RC-16391-01 50 μL

Recombinant COX IV Antibody

Sign In for Pricing
View Details
Recombinant COX IV Antibody
RC-16391-02 100 µL

Recombinant COX IV Antibody

Sign In for Pricing
View Details
Recombinant COX IV Antibody
RC-16391-03 1 mL

Recombinant COX IV Antibody

Sign In for Pricing
View Details
VR1 (TRPV1) Rabbit Polyclonal Antibody
TA371423 100 µL

VR1 (TRPV1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details