Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Vomeronasal type-1 receptor 41 (Vmn1r41)

This Recombinant Rat Vomeronasal type-1 receptor 41 (Vmn1r41) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Vomeronasal type-1 receptor 41, Pheromone receptor VN5, Vomeronasal receptor 5, Vomeronasal type-1 receptor B12, Vomeronasal type-1 receptor B9

UniProt

Q5J3M9

Expression Region

1-310

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKDNILHTDTNIKITLFSEVSIGISANSALFFSHLFMLFEKNRSKPIDLYIAFLSLTQL MLLITIGLIAADMFMSRGRWDSTTCQSLIYLHRLLRGFTLCATCLLNVLWTITLSPRSSC LTTFKHKSPHHISGAFLFFCVLYISFGSHLFLSTIATPNLTSDNFMYVTQSCSFLPMSYS RTSMFSTPMAIREALLIGLIGLSSGYMVAFLWRHKNQARHLHSTSLSSKVSPEQRATRTI MILMSFFVVLYILENVVFYSRMTFKDGSMFYCVQIIVSHSYATISPFVFICTEKRIIKLW GSMSSRIVSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-500 1x 500 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-500 1x 500 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-500 1x 500 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (Leukocyte Marker) (K4B5), CF405S conjugate, 0.1mg/mL
BNC041680-100 1x 100 µL

CD45RA (Leukocyte Marker) (K4B5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/845), CF640R conjugate, 0.1mg/mL
BNC400845-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/845), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details