Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Chitin synthase export chaperone (CHS7)

This Recombinant Candida albicans Chitin synthase export chaperone (CHS7) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Chitin synthase export chaperone

UniProt

Q5AA40

Expression Region

1-310

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFGSFDHICNKTALPLCSVVGAVNQSAFFQRGIVPDCYARSVELANTMIFQIGNAFVHF GGLIILLIIIFNVRAKYTAIGRKEMLFFLYLAIGLIVSSLIVDCGVSPPSSTSYAYFVAV QIGLSSALCICLLYNGFLCFQFWEDGTSRSMWILRVGCFAWFAVNFIVCIITFKHWDTAL DYRKTTTLFIFAYVLNAVILAVYVVSQIILVVFALESYWSLGAILLGVFFFVAGQVLTYV FSDKICRGASHYVDGLFFGSACNVFTFMMIYKFWDMITSDDLEFSVANVEQPINEFGVGA DDEKRSSMFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prohibitin Recombinant Rabbit Monoclonal Antibody [SR46-02]
ET1602-31 100 µL

Prohibitin Recombinant Rabbit Monoclonal Antibody [SR46-02]

Sign In for Pricing
View Details
Fast EvaGreen® Master Mix for qPCR (500 rxn)
#31003-1 5x 1 mL

Fast EvaGreen® Master Mix for qPCR (500 rxn)

Sign In for Pricing
View Details
Recombinant Human SR-BI/CD36L1 Protein (His Tag)
PKSH031282 50 µg

Recombinant Human SR-BI/CD36L1 Protein (His Tag)

Sign In for Pricing
View Details
CD90 Antibody (Biotin)
KB-27111-01 50 μL

CD90 Antibody (Biotin)

Sign In for Pricing
View Details
CD90 Antibody (Biotin)
KB-27111-02 100 µL

CD90 Antibody (Biotin)

Sign In for Pricing
View Details
CD90 Antibody (Biotin)
KB-27111-03 1 mL

CD90 Antibody (Biotin)

Sign In for Pricing
View Details