Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Chitin synthase export chaperone (CHS7)

This Recombinant Candida albicans Chitin synthase export chaperone (CHS7) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Chitin synthase export chaperone

UniProt

Q5AA40

Expression Region

1-310

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFGSFDHICNKTALPLCSVVGAVNQSAFFQRGIVPDCYARSVELANTMIFQIGNAFVHF GGLIILLIIIFNVRAKYTAIGRKEMLFFLYLAIGLIVSSLIVDCGVSPPSSTSYAYFVAV QIGLSSALCICLLYNGFLCFQFWEDGTSRSMWILRVGCFAWFAVNFIVCIITFKHWDTAL DYRKTTTLFIFAYVLNAVILAVYVVSQIILVVFALESYWSLGAILLGVFFFVAGQVLTYV FSDKICRGASHYVDGLFFGSACNVFTFMMIYKFWDMITSDDLEFSVANVEQPINEFGVGA DDEKRSSMFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desktop Trace Drug Detector DT BDRD-202
BDRD-202 1 Unit

Desktop Trace Drug Detector DT BDRD-202

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1485), Biotin conjugate, 0.1mg/mL
BNCB1485-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1485), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR2AT4 Human Gene Knockout Kit (CRISPR)
KN424618 1 Kit

OR2AT4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: femur, distal
CS710631 5x 5 µm

Tissue FFPE Sections, Bone: femur, distal

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712448 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501030 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details