Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Taste receptor type 2 member 125 (Tas2r125)

This Recombinant Rat Taste receptor type 2 member 125 (Tas2r125) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 125, T2r125, Taste receptor type 2 member 16, T2R16

UniProt

Q67ET4

Expression Region

1-310

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGIVIGIICAFIIIVQFIIGNVANGFIALVNIIDWVKRRKISLVDQIITALAISRIDMLC STFLIVLITSLYPDLNTAVNMVKISNNIWIVANHFSIWLATSLSIFYFLKIANFSNYVFL CLRWRLSKVVSVTLLLSLVLLLMNILIMNMHIDTWSDGFKRNVSFGFRSKNCTRFFKLAL LINTTFTCVPFTVSMVAFLLLIFSLWRHLKNMQYHAKGSRDPSTAVHIKALQMVVVFVLF YTFFFLSLAIQLWTSESLEKNNLFYVTLIITFPSVHSCMLILRNSKLRQASLLVLWWLLC RSKDIQTLVP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-100 1x 100 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-500 1x 500 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF488A conjugate, 0.1mg/mL
BNC880821-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (OKT3), CF647 conjugate, 0.1mg/mL
BNC470268-500 1x 500 µL

CD3e (T-Cell Marker) (OKT3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc (MYC275), CF647 conjugate, 0.1mg/mL
BNC470275-500 1x 500 µL

C-Myc (MYC275), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), CF568 conjugate, 0.1mg/mL
BNC682054-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details