Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 8 (Olfr8)

This Recombinant Mouse Olfactory receptor 8 (Olfr8) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 8, Odorant receptor M64

UniProt

Q60892

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESGNSTRRIPSFFLLGFSENPHLQFLIFVLFLSMYLVTVLGNLLIIMVIITQSPLHTPM YFFLANLSFVDICFTSTTVPKMLVNIQTQSKAITYADCISQMSVFLVFAELDNFLLAVMA YDRYVAICHPLYYTFIVNQHLCILMVLLSWVVSILHAFLQSSIVLQLTFCGDVKIPHFFC ELNQLSQLTCLDSLSSHLIMNLVPVLLAVISFSSILYSYFKIVSSICSISSVQGKYTAFS TCVSHLSIVFLFYSTGLGVYVSSAVVQSSHSAARASVMYTVVTPMLNPFIYSLRNKDVKK ALERLLEGKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ZMAT4 shRNA (UAS) - Lentiviral human ZMAT4 shRNA (UAS, RFP) (25)
GTR15148679 1 Vial

Lentiviral human ZMAT4 shRNA (UAS) - Lentiviral human ZMAT4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Mouse Ext2 Pre-designed siRNA Set A
SI104526A 1 Each

Mouse Ext2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Human MIP-1 beta (CCL4L1)
Z102107 100 µg

Recombinant Human MIP-1 beta (CCL4L1)

Sign In for Pricing
View Details
PCMV6-GBE1-3*FLAG
BZ65082 1 Vial

PCMV6-GBE1-3*FLAG

Sign In for Pricing
View Details
RBPMS2 Antibody
orb1245730 100 µL

RBPMS2 Antibody

Sign In for Pricing
View Details
Cryo-Tags, white labels for bottles and beakers, 3.0 inch L x 2.0 inch W, 12/sheet (240 labels/box)
9187-3020 240 Labels/Box

Cryo-Tags, white labels for bottles and beakers, 3.0 inch L x 2.0 inch W, 12/sheet (240 labels/box)

Sign In for Pricing
View Details