Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 8 (Olfr8)

This Recombinant Mouse Olfactory receptor 8 (Olfr8) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 8, Odorant receptor M64

UniProt

Q60892

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESGNSTRRIPSFFLLGFSENPHLQFLIFVLFLSMYLVTVLGNLLIIMVIITQSPLHTPM YFFLANLSFVDICFTSTTVPKMLVNIQTQSKAITYADCISQMSVFLVFAELDNFLLAVMA YDRYVAICHPLYYTFIVNQHLCILMVLLSWVVSILHAFLQSSIVLQLTFCGDVKIPHFFC ELNQLSQLTCLDSLSSHLIMNLVPVLLAVISFSSILYSYFKIVSSICSISSVQGKYTAFS TCVSHLSIVFLFYSTGLGVYVSSAVVQSSHSAARASVMYTVVTPMLNPFIYSLRNKDVKK ALERLLEGKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexahydro-2-methyl-1- (p-toluenesulfonyl) -4- (t-butoxycarbonyl) -1,4-diazepine
H2034-91U 100 mg

Hexahydro-2-methyl-1- (p-toluenesulfonyl) -4- (t-butoxycarbonyl) -1,4-diazepine

Sign In for Pricing
View Details
12a-Hydroxyrotenonic acid
orb1992443-01 1 mg

12a-Hydroxyrotenonic acid

Sign In for Pricing
View Details
12a-Hydroxyrotenonic acid
orb1992443-02 5 mg

12a-Hydroxyrotenonic acid

Sign In for Pricing
View Details
Paper filter disc diam.110mm very fast quantitative 45 25,0um retention GVS 100 pc
FP110DSL45QANC01 100 Pieces/Case:100 Pieces/ PACKS:1 PACKS/CASE

Paper filter disc diam.110mm very fast quantitative 45 25,0um retention GVS 100 pc

Sign In for Pricing
View Details
Human UBE2B Recombinant Protein Tag Free Liquid
MBS8433677-01 0.05 mg

Human UBE2B Recombinant Protein Tag Free Liquid

Sign In for Pricing
View Details
Human UBE2B Recombinant Protein Tag Free Liquid
MBS8433677-02 5x 0.05 mg

Human UBE2B Recombinant Protein Tag Free Liquid

Sign In for Pricing
View Details