Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 145 (Olfr145)

This Recombinant Mouse Olfactory receptor 145 (Olfr145) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 145, Odorant receptor K21, Olfactory receptor 161-6, Olfactory receptor 7C

UniProt

Q60882

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATENASVPEFILAGLTDQPGLRMPLFFLFLGFYMVTMVGNLGLITLIGLNSHLHTPMYF FLFNLSLIDFCYSTVITPKMLVSFVSKKNIISYSGCMTQLFFFLFFVVSESFILSAMAYD RYVAICNPLMYTVTMSPQVCLLLLLGVYVMGFAGAMAHTAFMVKLTFCADKLVNHYMCDI LPLLERSCTSTYVNELVVFIVVGIDIGVPTVTIFISYALILSSILRISSTEGRSKAFSTC SSHIIAVSLFFGSGAFMYLKPSSLLPMNQGKVSSLFYTIVVPMLNPLIYSLRNKDVKVAL RKTLSRSSFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PRKCD Protein, N-His
AP92069 50 µg

Recombinant Human PRKCD Protein, N-His

Sign In for Pricing
View Details
Guinea Pig Activated CDC42 kinase 1 (TNK2) ELISA kit
GTR10395055 96 Well

Guinea Pig Activated CDC42 kinase 1 (TNK2) ELISA kit

Sign In for Pricing
View Details
Zcrb1 Rabbit Polyclonal Antibody (Cy5.5)
orb1072957 100 µL

Zcrb1 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Recombinant Petromyzon marinus Lamprin 1.8-10
MBS1248503-01 0.02 mg (E-Coli)

Recombinant Petromyzon marinus Lamprin 1.8-10

Sign In for Pricing
View Details
Recombinant Petromyzon marinus Lamprin 1.8-10
MBS1248503-02 0.1 mg (E-Coli)

Recombinant Petromyzon marinus Lamprin 1.8-10

Sign In for Pricing
View Details
Recombinant Petromyzon marinus Lamprin 1.8-10
MBS1248503-03 0.02 mg (Yeast)

Recombinant Petromyzon marinus Lamprin 1.8-10

Sign In for Pricing
View Details