Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 148 (Olfr148)

This Recombinant Mouse Olfactory receptor 148 (Olfr148) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 148, Odorant receptor M30, Olfactory receptor 224-4, Olfactory receptor 7F

UniProt

Q60887

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNYTLLNEFILLGIPQTQGLETLLFVVFLFIYFFTLLGNSLIFTAIISSSTLHTPMYFF LGLLSVFDMLFPSVTCPKMLFYLSVRSPAISYKGCAAQLFFYHLLGSTEGCLYSVMAYDR YVAICHPLRYMLIMKPGVCVSLVIIAWLVGCLHATILTSLTFQLVYCASNQVDYFFCDLP AVLPLACTDSKLARKVGSINVGFLALMLLFSVCVSYVHIGVAILRIRSAEGRQKAFSTCS AHLTAILCAYGPVIIIYLQRTPNPLLGAVVQILNNIVSPMLNSLIYSLRNKEVKRSLRRV FQNITFHGQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SA1 (STAG1) (NM_005862) Human Over-expression Lysate
LH07901V 100 µg

SA1 (STAG1) (NM_005862) Human Over-expression Lysate

Sign In for Pricing
View Details
AMPKβ1 (H17) polyclonal antibody
BS2406 50ul

AMPKβ1 (H17) polyclonal antibody

Sign In for Pricing
View Details
PPM1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C2]
TA502812AM 100 µL

PPM1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C2]

Sign In for Pricing
View Details
Wfdc2 Rat shRNA Lentiviral Particle (Locus ID 286888)
TL713339V 500 µL Each

Wfdc2 Rat shRNA Lentiviral Particle (Locus ID 286888)

Sign In for Pricing
View Details
Betahistine mesylate
S5498-25mg 25 mg

Betahistine mesylate

Sign In for Pricing
View Details
Tmem88 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
47103116 3x 1.0 µg

Tmem88 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details