Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 148 (Olfr148)

This Recombinant Mouse Olfactory receptor 148 (Olfr148) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 148, Odorant receptor M30, Olfactory receptor 224-4, Olfactory receptor 7F

UniProt

Q60887

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNYTLLNEFILLGIPQTQGLETLLFVVFLFIYFFTLLGNSLIFTAIISSSTLHTPMYFF LGLLSVFDMLFPSVTCPKMLFYLSVRSPAISYKGCAAQLFFYHLLGSTEGCLYSVMAYDR YVAICHPLRYMLIMKPGVCVSLVIIAWLVGCLHATILTSLTFQLVYCASNQVDYFFCDLP AVLPLACTDSKLARKVGSINVGFLALMLLFSVCVSYVHIGVAILRIRSAEGRQKAFSTCS AHLTAILCAYGPVIIIYLQRTPNPLLGAVVQILNNIVSPMLNSLIYSLRNKEVKRSLRRV FQNITFHGQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human NUDT17 shRNA (UAS) - Lentiviral human NUDT17 shRNA (UAS, GFP) (100)
GTR15078969 1 Vial

Lentiviral human NUDT17 shRNA (UAS) - Lentiviral human NUDT17 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor (VEGF)
MBS340507-01 10 mg

Vascular Endothelial Growth Factor (VEGF)

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor (VEGF)
MBS340507-02 0.5 mg

Vascular Endothelial Growth Factor (VEGF)

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor (VEGF)
MBS340507-03 5x 0.5 mg

Vascular Endothelial Growth Factor (VEGF)

Sign In for Pricing
View Details
EXDL1 (EXD1) Mouse Monoclonal Antibody [Clone ID: OTI5B5]
TA502098 100 µL

EXDL1 (EXD1) Mouse Monoclonal Antibody [Clone ID: OTI5B5]

Sign In for Pricing
View Details
CD3G Mouse Monoclonal Antibody
AMM82031-01 1 Each

CD3G Mouse Monoclonal Antibody

Sign In for Pricing
View Details