Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4C11 (OR4C11)

This Recombinant Human Olfactory receptor 4C11 (OR4C11) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 4C11, Olfactory receptor OR11-136

UniProt

Q6IEV9

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQNNSVPEFILLGLTQDPLRQKIVFVIFLIFYMGTVVGNMLIIVTIKSSRTLGSPMYFF LFYLSFADSCFSTSTAPRLIVDALSEKKIITYNECMTQVFALHLFGCMEIFVLILMAVDR YVAICKPLRYPTIMSQQVCIILIVLAWIGSLIHSTAQIILALRLPFCGPYLIDHYCCDLQ PLLKLACMDTYMINLLLVSNSGAICSSSFMILIISYIVILHSLRNHSAKGKKKALSACTS HIIVVILFFGPCIFIYTRPPTTFPMDKMVAVFYTIGTPFLNPLIYTLRNAEVKNAMRKLW HGKIISENKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endostatin (COL18A1) Mouse Monoclonal Antibody [Clone ID: 1837-46]
BM4098 200 µg

Endostatin (COL18A1) Mouse Monoclonal Antibody [Clone ID: 1837-46]

Sign In for Pricing
View Details
Mouse TMEM160 shRNA Plasmid
abx976848-01 150 µg

Mouse TMEM160 shRNA Plasmid

Sign In for Pricing
View Details
Mouse TMEM160 shRNA Plasmid
abx976848-02 300 µg

Mouse TMEM160 shRNA Plasmid

Sign In for Pricing
View Details
Field Stain B
STHEFSB-1000 1000 mL

Field Stain B

Sign In for Pricing
View Details
RasGRP2 CRISPR Activation Plasmid (h2)
sc-408690-ACT-2 20 µg

RasGRP2 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
PRB4 Peptide - middle region
MBS3247562-01 0.1 mg

PRB4 Peptide - middle region

Sign In for Pricing
View Details