Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Leontopithecus chrysomelas Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Leontopithecus chrysomelas Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864I1

Expression Region

1-310

Origin

Leontopithecus chrysomelas (Golden-headed lion tamarin)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPMQGAQRKLLGSLNSTPTATSNLGLAANRTGAPCLELPIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLEAGVLATRASVVQQLHNTIDVLTCSSM LCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAVAAIWVASVLSSTLFITYYDHAAV LLCLVVFFLAMLVLMAVLYVHMLAWACQHAQGIIRLHKRQPPAHKGFGLRGAATLTILLG IFFLCWGPFFLRLTLVVFCPQHLTCNCIFKNFKVFLTLIICNTIIDPLIYAFRSQELRRT LKEVLGRGRW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2S Human Gene Knockout Kit (CRISPR)
KN424851 1 Kit

UBE2S Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tmod1 Mouse Gene Knockout Kit (CRISPR)
KN517925 1 Kit

Tmod1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), 0.2mg/mL
BNUB1878-500 1x 500 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant DAPK2 Antibody
RC-4942-01 50 μL

Recombinant DAPK2 Antibody

Sign In for Pricing
View Details
Recombinant DAPK2 Antibody
RC-4942-02 100 µL

Recombinant DAPK2 Antibody

Sign In for Pricing
View Details
Recombinant DAPK2 Antibody
RC-4942-03 1 mL

Recombinant DAPK2 Antibody

Sign In for Pricing
View Details