Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Leontopithecus chrysomelas Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Leontopithecus chrysomelas Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864I1

Expression Region

1-310

Origin

Leontopithecus chrysomelas (Golden-headed lion tamarin)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPMQGAQRKLLGSLNSTPTATSNLGLAANRTGAPCLELPIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLEAGVLATRASVVQQLHNTIDVLTCSSM LCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAVAAIWVASVLSSTLFITYYDHAAV LLCLVVFFLAMLVLMAVLYVHMLAWACQHAQGIIRLHKRQPPAHKGFGLRGAATLTILLG IFFLCWGPFFLRLTLVVFCPQHLTCNCIFKNFKVFLTLIICNTIIDPLIYAFRSQELRRT LKEVLGRGRW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FMO5 (NM_001461) Human Recombinant Protein
TP314057L 1 mg

FMO5 (NM_001461) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703862 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
GRP94 Mouse Monoclonal Antibody [F1-D10-G3]
M1701-12 100 µL

GRP94 Mouse Monoclonal Antibody [F1-D10-G3]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013UI-01 25 µg

PE/Cyanine5.5 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD3 Antibody[17A2]
E-AB-F1013UI-02 100 µg

PE/Cyanine5.5 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
2,4'-Bisphenol A
TRC-B519490-250MG 250 mg

2,4'-Bisphenol A

Sign In for Pricing
View Details