Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4K14 (OR4K14)

This Recombinant Human Olfactory receptor 4K14 (OR4K14) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 4K14, Olfactory receptor OR14-22

UniProt

Q8NGD5

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQNYSLVSEFVLHGLCTSRHLQNFFFIFFFGVYVAIMLGNLLILVTVISDPCLHSSPM YFLLGNLAFLDMWLASFATPKMIRDFLSDQKLISFGGCMAQIFFLHFTGGAEMVLLVSMA YDRYVAICKPLHYMTLMSWQTCIRLVLASWVVGFVHSISQVAFTVNLPYCGPNEVDSFFC DLPLVIKLACMDTYVLGIIMISDSGLLSLSCFLLLLISYTVILLAIRQRAAGSTSKALST CSAHIMVVTLFFGPCIFVYVRPFSRFSVDKLLSVFYTIFTPLLNPIIYTLRNEEMKAAMK KLQNRRVTFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRP Polyclonal Antibody
D-AB-10393L-01 25 µL

CRP Polyclonal Antibody

Sign In for Pricing
View Details
CRP Polyclonal Antibody
D-AB-10393L-02 100 µL

CRP Polyclonal Antibody

Sign In for Pricing
View Details
Rat Left/Right Determination Factor 1 (LEFTY1) ELISA Kit
RD-LEFTY1-Ra-01 96 Tests

Rat Left/Right Determination Factor 1 (LEFTY1) ELISA Kit

Sign In for Pricing
View Details
Rat Left/Right Determination Factor 1 (LEFTY1) ELISA Kit
RD-LEFTY1-Ra-02 48 Tests

Rat Left/Right Determination Factor 1 (LEFTY1) ELISA Kit

Sign In for Pricing
View Details
Ceftiofur Thiolactone
TRC-C244730-25MG 25 mg

Ceftiofur Thiolactone

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS644363 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details