Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 491 (Olfr491)

This Recombinant Mouse Olfactory receptor 491 (Olfr491) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 491, Olfactory receptor 204-11

UniProt

Q8VG06

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPGNHTAVTKFILLGLTDDPTLCVIFFVFFLGIYIVTLVGNISIINLVRSCPQLQTPMY MFLSHLAFVDIGYSTSVTPIMLIGFIVHETGLPVHACEAQLCSVVTFGTAECFLLAAMAY DRYVAICSPLLYSTHMSSQICLLLVGASYVGGCVNAWTFTGCLLSLSFCGPNKIDHFFCD FSPLLKLSCSDVSIIGIIPSISAGSIIVVTVFVISVSYIYILITILKMRSTEGRHKAFST CTSHLTAVTLYYGTITFIYVMPKSSYSTKQNRVVSLFYTVVIPMLNPLIYSLRNRDVKEA LRKATLRIYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Breast
CR560884 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Crisp1 Mouse Gene Knockout Kit (CRISPR)
KN503830 1 Kit

Crisp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CELA3B (CELA3B/1218), CF740 conjugate, 0.1mg/mL
BNC741218-500 1x 500 µL

CELA3B (CELA3B/1218), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RNF148 Polyclonal Antibody
E-AB-13572-01 20 µL

RNF148 Polyclonal Antibody

Sign In for Pricing
View Details
RNF148 Polyclonal Antibody
E-AB-13572-02 60 µL

RNF148 Polyclonal Antibody

Sign In for Pricing
View Details
RNF148 Polyclonal Antibody
E-AB-13572-03 120 µL

RNF148 Polyclonal Antibody

Sign In for Pricing
View Details