Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2A14 (OR2A14)

This Recombinant Human Olfactory receptor 2A14 (OR2A14) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 2A14, OST182, Olfactory receptor 2A6, Olfactory receptor OR7-12

UniProt

Q96R47

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGNKTWITDITLPRFQVGPALEILLCGLFSAFYTLTLLGNGVIFGIICLDCKLHTPMYF FLSHLAIVDISYASNYVPKMLTNLMNQESTISFFPCIMQTFLYLAFAHVECLILVVMSYD RYADICHPLRYNSLMSWRVCTVLAVASWVFSFLLALVPLVLILSLPFCGPHEINHFFCEI LSVLKLACADTWLNQVVIFAACVFILVGPLCLVLVSYLRILAAILRIQSGEGRRKAFSTC SSHLCVVGLFFGSAIVTYMAPKSRHPEEQQKVLSLFYSLFNPMLNPLIYSLRNAEVKGAL RRALRKERLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIN3B Rabbit Polyclonal Antibody
TA367256 100 µL

SIN3B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZP1 Antibody
8C19635-AAT 50 µg

ZP1 Antibody

Sign In for Pricing
View Details
Melanoma Marker (HMB45 + A103 + T311), CF647 conjugate, 0.1mg/mL
BNC470702-500 1x 500 µL

Melanoma Marker (HMB45 + A103 + T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Abamectin B1a
TRC-A794665-1MG 1 mg

Abamectin B1a

Sign In for Pricing
View Details
Mix-n-StainTM CF®750 Antibody Labeling Kit, 1x (50-100ug) labeling
#92241 1 Kit

Mix-n-StainTM CF®750 Antibody Labeling Kit, 1x (50-100ug) labeling

Sign In for Pricing
View Details
KRT35 (NM_002280) Human Over-expression Lysate
LC419432 20 µg

KRT35 (NM_002280) Human Over-expression Lysate

Sign In for Pricing
View Details