Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2A14 (OR2A14)

This Recombinant Human Olfactory receptor 2A14 (OR2A14) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 2A14, OST182, Olfactory receptor 2A6, Olfactory receptor OR7-12

UniProt

Q96R47

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGNKTWITDITLPRFQVGPALEILLCGLFSAFYTLTLLGNGVIFGIICLDCKLHTPMYF FLSHLAIVDISYASNYVPKMLTNLMNQESTISFFPCIMQTFLYLAFAHVECLILVVMSYD RYADICHPLRYNSLMSWRVCTVLAVASWVFSFLLALVPLVLILSLPFCGPHEINHFFCEI LSVLKLACADTWLNQVVIFAACVFILVGPLCLVLVSYLRILAAILRIQSGEGRRKAFSTC SSHLCVVGLFFGSAIVTYMAPKSRHPEEQQKVLSLFYSLFNPMLNPLIYSLRNAEVKGAL RRALRKERLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRSF1 Human Knockdown Lysate
LY300186 100 µg

GRSF1 Human Knockdown Lysate

Sign In for Pricing
View Details
Biological Microscope BMIC-702
BMIC-702 1 Unit

Biological Microscope BMIC-702

Sign In for Pricing
View Details
Taf7l Mouse Gene Knockout Kit (CRISPR)
KN517154 1 Kit

Taf7l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD28 (204.12), 0.2mg/mL
BNUB0164-500 1x 500 µL

CD28 (204.12), 0.2mg/mL

Sign In for Pricing
View Details
RPN1 Antibody
KC-31742-01 50 μL

RPN1 Antibody

Sign In for Pricing
View Details
RPN1 Antibody
KC-31742-02 100 µL

RPN1 Antibody

Sign In for Pricing
View Details