Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2A14 (OR2A14)

This Recombinant Human Olfactory receptor 2A14 (OR2A14) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 2A14, OST182, Olfactory receptor 2A6, Olfactory receptor OR7-12

UniProt

Q96R47

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGNKTWITDITLPRFQVGPALEILLCGLFSAFYTLTLLGNGVIFGIICLDCKLHTPMYF FLSHLAIVDISYASNYVPKMLTNLMNQESTISFFPCIMQTFLYLAFAHVECLILVVMSYD RYADICHPLRYNSLMSWRVCTVLAVASWVFSFLLALVPLVLILSLPFCGPHEINHFFCEI LSVLKLACADTWLNQVVIFAACVFILVGPLCLVLVSYLRILAAILRIQSGEGRRKAFSTC SSHLCVVGLFFGSAIVTYMAPKSRHPEEQQKVLSLFYSLFNPMLNPLIYSLRNAEVKGAL RRALRKERLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBPF6 (NM_001143987) Human Over-expression Lysate
LY428447 100 µg

NBPF6 (NM_001143987) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Renal pelvis
CS710408 5x 5 µm

Tissue FFPE Sections, Renal pelvis

Sign In for Pricing
View Details
ADAM11 (NM_002390) Human Over-expression Lysate
LC419357 20 µg

ADAM11 (NM_002390) Human Over-expression Lysate

Sign In for Pricing
View Details
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), Biotin conjugate, 0.1mg/mL
BNCB2137-100 1x 100 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DA7), CF647 conjugate, 0.1mg/mL
BNC470198-500 1x 500 µL

Cytokeratin 18 (DA7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DCBLD2 Antibody
KC-2479-01 50 μL

DCBLD2 Antibody

Sign In for Pricing
View Details