Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5AR1 (OR5AR1)

This Recombinant Human Olfactory receptor 5AR1 (OR5AR1) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 5AR1, Olfactory receptor OR11-209

UniProt

Q8NGP9

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKENSSMVTEFIFMGITQDPQMEIIFFVVFLIVYLVNVVGNIGMIILITTDTQLHTPMY FFLCNLSFVDLGYSSAIAPRMLADFLTNHKVISFSSCATQFAFFVGFVDAECYVLAAMAY GRFVAICRPLHYSTFMSKQVCLALMLGSYLAGLVSLVAHTTLTFSLSYCGSNIINHFFCE IPPLLALSCSDTYISEILLFSLCGFIEFSTILIIFISYTFILVAIIRMRSAEGRLKAFST CGSHLTGITLFYGTVMFMYLRPTSSYSLDQDKWASVFYTVIIPMLNPLIYSLRNKDVKAA FKKLIGKKSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lipin 1 (LPIN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C11]
TA806417AM 100 µL

Lipin 1 (LPIN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C11]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse H-2 Antibody[M1/42]
E-AB-F12160-01 100 µg

AF/LE Purified Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse H-2 Antibody[M1/42]
E-AB-F12160-02 1 mg

AF/LE Purified Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse H-2 Antibody[M1/42]
E-AB-F12160-03 5 mg

AF/LE Purified Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse H-2 Antibody[M1/42]
E-AB-F12160-04 25 mg

AF/LE Purified Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse H-2 Antibody[M1/42]
E-AB-F12160-05 50 mg

AF/LE Purified Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details