Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 474 (Olfr474)

This Recombinant Mouse Olfactory receptor 474 (Olfr474) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 474, Olfactory receptor 204-20

UniProt

Q8VFC9

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGGNHTSMTELFILGPTEDPTFCIAFFVIFLGVYMVTLVGNISIITLIRISSQLHTPVY LFLNHLAFVDILYSTLVSVIMLMELLEHELALPVAACAAELCITVLFGSSECFLLAAMAY DCYVAICSPLLYSTLMSSRVCFLLLGMSYVGGCMNGWIFTGCLLNLSFYGPYQIDHFFCD FSPLLKLSCSDVSIIGIIPSISSGSIIVVTVLVIAVFYICILMTILKMHSTDGCHKAFST CNSYLTAVTLYYGTITFIYVMPKSNYSTEKNKVLSEFYTVVIPMLNHLIYSLKNRDVKDA LRKAIVRVYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AstA Antibody
orb810191 2 mg

AstA Antibody

Sign In for Pricing
View Details
Bovine Hepatocyte Cell Adhesion Molecule (HEPACAM) ELISA Kit
MBS9908465-01 48 Well

Bovine Hepatocyte Cell Adhesion Molecule (HEPACAM) ELISA Kit

Sign In for Pricing
View Details
Bovine Hepatocyte Cell Adhesion Molecule (HEPACAM) ELISA Kit
MBS9908465-02 96 Well

Bovine Hepatocyte Cell Adhesion Molecule (HEPACAM) ELISA Kit

Sign In for Pricing
View Details
Bovine Hepatocyte Cell Adhesion Molecule (HEPACAM) ELISA Kit
MBS9908465-03 5x 96 Well

Bovine Hepatocyte Cell Adhesion Molecule (HEPACAM) ELISA Kit

Sign In for Pricing
View Details
Bovine Hepatocyte Cell Adhesion Molecule (HEPACAM) ELISA Kit
MBS9908465-04 10x 96 Well

Bovine Hepatocyte Cell Adhesion Molecule (HEPACAM) ELISA Kit

Sign In for Pricing
View Details
IGF2BP2 Rabbit mAb
E60M3670 100 µL

IGF2BP2 Rabbit mAb

Sign In for Pricing
View Details