Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 508 (Olfr508)

This Recombinant Mouse Olfactory receptor 508 (Olfr508) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 508, Olfactory receptor 204-6

UniProt

Q8VG42

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPGNYTVVTEVILLGFTEDAIIRAILFIVFLIIYSVTLMGNASIIMLIRRSPQLHTPMY LLLSHLAFVDIGYSSSVTPIMLKGFLRKETFILVSGCVAQLCSVVTFGSTECFLLAAMAY DRYVAICSPLLYATQMSSTVCILLVGASYLGGCVNAWTFTGCLLNLSFCRPNKVNHFFCD YSPLLKISCSHDFSSEVIPAISSGSIIVVTVFIIALSYVYILVSILKMRSTEGRQKAFST CTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYTVVIPMLNPIIYSLRNKDVKEA MKKLMANTHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3'-Hydroxy simvastatin
HY-136345A 2.5 mg

3'-Hydroxy simvastatin

Sign In for Pricing
View Details
FAM98B Rabbit mAb
orb1564919-01 20 ul

FAM98B Rabbit mAb

Sign In for Pricing
View Details
FAM98B Rabbit mAb
orb1564919-02 50 µL

FAM98B Rabbit mAb

Sign In for Pricing
View Details
FAM98B Rabbit mAb
orb1564919-03 100 µL

FAM98B Rabbit mAb

Sign In for Pricing
View Details
Goat Anti-Human IgG Fc Biotin
L35036 1 mL

Goat Anti-Human IgG Fc Biotin

Sign In for Pricing
View Details
Dynorphin A Peptide
abx265497-01 5 mg

Dynorphin A Peptide

Sign In for Pricing
View Details