Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mas-related G-protein coupled receptor member E (Mrgpre)

This Recombinant Mouse Mas-related G-protein coupled receptor member E (Mrgpre) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member E, Evolutionary breakpoint transcript 3 protein

UniProt

Q91ZB7

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSLSVHTDSPSTQGEMAFNLTILSLTELLSLGGLLGNGVALWLLNQNVYRNPFSIYLLD VACADLIFLCCHMVAIIPELLQDQLNFPEFVHISLTMLRFFCYIVGLSLLAAISTEQCLA TLFPAWYLCRRPRYLTTCVCALIWVLCLLLDLLLSGACTQFFGAPSYHLCDMLWLVVAVL LAALCCTMCVTSLLLLLRVERGPERHQPRGFPTLVLLAVLLFLFCGLPFGIFWLSKNLSW HIPLYFYHFSFFMASVHSAAKPAIYFFLGSTPGQRFREPLRLVLQRALGDEAELGAGREA SQGGLVDMTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kaempferol 3-beta-Sophoroside
TRC-K100020-25MG 25 mg

Kaempferol 3-beta-Sophoroside

Sign In for Pricing
View Details
3-Formyl Rifamycin
TRC-F700950-10MG 10 mg

3-Formyl Rifamycin

Sign In for Pricing
View Details
SureStrain™ Premium Cell Strainers
C7030 50 Units/Pack

SureStrain™ Premium Cell Strainers

Sign In for Pricing
View Details
Recombinant Mouse Granzyme D/GZMD Protein (His Tag)
PKSM041036-01 10 µg

Recombinant Mouse Granzyme D/GZMD Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Granzyme D/GZMD Protein (His Tag)
PKSM041036-02 50 µg

Recombinant Mouse Granzyme D/GZMD Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat Angiopoietin-1/ANG1 protein (His tag)
PDER100186-01 20 µg

Recombinant Rat Angiopoietin-1/ANG1 protein (His tag)

Sign In for Pricing
View Details