Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mas-related G-protein coupled receptor member E (Mrgpre)

This Recombinant Mouse Mas-related G-protein coupled receptor member E (Mrgpre) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member E, Evolutionary breakpoint transcript 3 protein

UniProt

Q91ZB7

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSLSVHTDSPSTQGEMAFNLTILSLTELLSLGGLLGNGVALWLLNQNVYRNPFSIYLLD VACADLIFLCCHMVAIIPELLQDQLNFPEFVHISLTMLRFFCYIVGLSLLAAISTEQCLA TLFPAWYLCRRPRYLTTCVCALIWVLCLLLDLLLSGACTQFFGAPSYHLCDMLWLVVAVL LAALCCTMCVTSLLLLLRVERGPERHQPRGFPTLVLLAVLLFLFCGLPFGIFWLSKNLSW HIPLYFYHFSFFMASVHSAAKPAIYFFLGSTPGQRFREPLRLVLQRALGDEAELGAGREA SQGGLVDMTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acrylonitrile-d3
TRC-A191375-5MG 5 mg

Acrylonitrile-d3

Sign In for Pricing
View Details
Colloidal Gold Conjugated Allomyrina dichotoma Lectin (Japanese Beetle) -Allo A-,  40nm
GP-6401-40 1 mL

Colloidal Gold Conjugated Allomyrina dichotoma Lectin (Japanese Beetle) -Allo A-, 40nm

Sign In for Pricing
View Details
Pclaf Mouse Gene Knockout Kit (CRISPR)
KN500300 1 Kit

Pclaf Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS706306 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
BTBD3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13F6]
TA808669AM 100 µL

BTBD3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13F6]

Sign In for Pricing
View Details
TNFSF10 Polyclonal Antibody
E-AB-90335-01 60 µL

TNFSF10 Polyclonal Antibody

Sign In for Pricing
View Details