Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mas-related G-protein coupled receptor member E (Mrgpre)

This Recombinant Mouse Mas-related G-protein coupled receptor member E (Mrgpre) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member E, Evolutionary breakpoint transcript 3 protein

UniProt

Q91ZB7

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSLSVHTDSPSTQGEMAFNLTILSLTELLSLGGLLGNGVALWLLNQNVYRNPFSIYLLD VACADLIFLCCHMVAIIPELLQDQLNFPEFVHISLTMLRFFCYIVGLSLLAAISTEQCLA TLFPAWYLCRRPRYLTTCVCALIWVLCLLLDLLLSGACTQFFGAPSYHLCDMLWLVVAVL LAALCCTMCVTSLLLLLRVERGPERHQPRGFPTLVLLAVLLFLFCGLPFGIFWLSKNLSW HIPLYFYHFSFFMASVHSAAKPAIYFFLGSTPGQRFREPLRLVLQRALGDEAELGAGREA SQGGLVDMTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Rat CD44H Antibody[OX-49]
E-AB-F1225UD-01 25 µg

PE Anti-Rat CD44H Antibody[OX-49]

Sign In for Pricing
View Details
PE Anti-Rat CD44H Antibody[OX-49]
E-AB-F1225UD-02 100 µg

PE Anti-Rat CD44H Antibody[OX-49]

Sign In for Pricing
View Details
Phospholipase C gamma 1 (PLCG1) pTyr783 Rabbit Polyclonal Antibody
AP02395PU-S 50 µL

Phospholipase C gamma 1 (PLCG1) pTyr783 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WBSCR16 (RCC1L) (NM_148842) Human Tagged ORF Clone
RG238316 10 µg

WBSCR16 (RCC1L) (NM_148842) Human Tagged ORF Clone

Sign In for Pricing
View Details
C-Jun Antibody
KC-545-01 50 μL

C-Jun Antibody

Sign In for Pricing
View Details
C-Jun Antibody
KC-545-02 100 µL

C-Jun Antibody

Sign In for Pricing
View Details