Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5M9 (OR5M9)

This Recombinant Human Olfactory receptor 5M9 (OR5M9) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 5M9, Olfactory receptor OR11-190

UniProt

Q8NGP3

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPNFTDVTEFTLLGLTCRQELQVLFFVVFLAVYMITLLGNIGMIILISISPQLQSPMYFF LSHLSFADVCFSSNVTPKMLENLLSETKTISYVGCLVQCYFFIAVVHVEVYILAVMAFDR YMAGCNPLLYGSKMSRTVCVRLISVPYVYGFSVSLICTLWTYGLYFCGNFEINHFYCADP PLIQIACGRVHIKEITMIVIAGINFTYSLSVVLISYTLIVVAVLRMRSADGRRKAFSTCG SHLTAVSMFYGTPIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAVN KAITKTYVRQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD244 Protein (Fc Tag)
PDMH100240-01 20 µg

Recombinant Human CD244 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CD244 Protein (Fc Tag)
PDMH100240-02 100 µg

Recombinant Human CD244 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CD244 Protein (Fc Tag)
PDMH100240-03 500 µg

Recombinant Human CD244 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CD244 Protein (Fc Tag)
PDMH100240-04 1 mg

Recombinant Human CD244 Protein (Fc Tag)

Sign In for Pricing
View Details
Apc5 (ANAPC5) (NM_016237) Human Over-expression Lysate
LC402524 20 µg

Apc5 (ANAPC5) (NM_016237) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 3 (KRT3) Human Gene Knockout Kit (CRISPR)
KN423011 1 Kit

Cytokeratin 3 (KRT3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details