Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 477 (Olfr477)

This Recombinant Mouse Olfactory receptor 477 (Olfr477) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 477, Olfactory receptor 204-1

UniProt

Q8VGI6

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAQNHTTVKEFILLGLTENSTLRVILFMIFLGIYTVTLVGNFSIISLIRSCPQLHTPMY LFLSHLALVDIGFSTSITPIMLTGFLGHTVTLSVAACVAQFCIAVTFGTVECFLLAVMAY DRYVAICSPLLYSTHMSPRICFLLVGASYVGGCVNSGTFTSCLLILSFCGPNQIDHFFCD FPAVLKLSCSDVSIIGIIPSISAGSIIVITVFVIAVSYTYILITILNMRSTEGRHKAFST CTSHLTAVTLYYGTITFIYVMPKSNYSTAQNKILSVFYTVVIPMLNPLIYSLRNRDVKEA LRKAIIRIFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCVRN CRISPR All-in-one AAV vector set (with saCas9)(Human)
38758151 3x 1.0 µg DNA

RCVRN CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
CYP2C6 (K1) Alexa Fluor® 546
sc-53245 AF546 200 µg/mL

CYP2C6 (K1) Alexa Fluor® 546

Sign In for Pricing
View Details
Phospho-MCSF Receptor (Tyr561) Polyclonal Antibody, Cy7 Conjugated
bs-18735R-Cy7 100 µL

Phospho-MCSF Receptor (Tyr561) Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
PDGFR-β (phospho Tyr740) Polyclonal Antibody
orb1415025 100 µL

PDGFR-β (phospho Tyr740) Polyclonal Antibody

Sign In for Pricing
View Details
ZNF690 / ZSCAN29 (ZSCAN29/2610), CF740 conjugate, 0.1mg/mL
BNC742610-500 1x 500 µL

ZNF690 / ZSCAN29 (ZSCAN29/2610), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LC3A/LC3B Polyclonal Antibody
RD83388A-01 60 μL

LC3A/LC3B Polyclonal Antibody

Sign In for Pricing
View Details