Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4C16 (OR4C16)

This Recombinant Human Olfactory receptor 4C16 (OR4C16) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 4C16, Olfactory receptor OR11-135

UniProt

Q8NGL9

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLNNNVTEFILLGLTQDPFWKKIVFVIFLRLYLGTLLGNLLIIISVKTSQALKNPMFFF LFYLSLSDTCLSTSITPRMIVDALLKKTTISFSECMIQVFSSHVFGCLEIFILILTAVDR YVDICKPLHYMTIISQWVCGVLMAVAWVGSCVHSLVQIFLALSLPFCGPNVINHCFCDLQ PLLKQACSETYVVNLLLVSNSGAICAVSYVMLIFSYVIFLHSLRNHSAEVIKKALSTCVS HIIVVILFFGPCIFMYTCLATVFPMDKMIAVFYTVGTSFLNPVIYTLKNTEVKSAMRKLW SKKLITDDKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dapk1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6465004 1.0 µg DNA

Dapk1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
RAF1, phosphorylated (Ser494) (RAF Proto-oncogene Serine/Threonine-protein Kinase, Proto-oncogene c-RAF, Raf-1, C-RAF, cRaf, RAF) (MaxLight 650) discontinued
R0495-09G6-ML650 100 µL

RAF1, phosphorylated (Ser494) (RAF Proto-oncogene Serine/Threonine-protein Kinase, Proto-oncogene c-RAF, Raf-1, C-RAF, cRaf, RAF) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Recombinant Xenopus tropicalis Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1 (nkain1)
orb2918416-01 20 µg

Recombinant Xenopus tropicalis Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1 (nkain1)

Sign In for Pricing
View Details
Recombinant Xenopus tropicalis Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1 (nkain1)
orb2918416-02 100 µg

Recombinant Xenopus tropicalis Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1 (nkain1)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human GRIA1 (Glutamate ionotropic receptor AMPA type subunit 1) for Antibody Discovery
MP0622J Each

Magic™ Membrane Protein Human GRIA1 (Glutamate ionotropic receptor AMPA type subunit 1) for Antibody Discovery

Sign In for Pricing
View Details
Hsa-miR-10b-5p miRNA Inhibitor
CIH0059-01 10 nmol

Hsa-miR-10b-5p miRNA Inhibitor

Sign In for Pricing
View Details