Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4C16 (OR4C16)

This Recombinant Human Olfactory receptor 4C16 (OR4C16) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 4C16, Olfactory receptor OR11-135

UniProt

Q8NGL9

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLNNNVTEFILLGLTQDPFWKKIVFVIFLRLYLGTLLGNLLIIISVKTSQALKNPMFFF LFYLSLSDTCLSTSITPRMIVDALLKKTTISFSECMIQVFSSHVFGCLEIFILILTAVDR YVDICKPLHYMTIISQWVCGVLMAVAWVGSCVHSLVQIFLALSLPFCGPNVINHCFCDLQ PLLKQACSETYVVNLLLVSNSGAICAVSYVMLIFSYVIFLHSLRNHSAEVIKKALSTCVS HIIVVILFFGPCIFMYTCLATVFPMDKMIAVFYTVGTSFLNPVIYTLKNTEVKSAMRKLW SKKLITDDKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit SMARCD1/BAF60a Antibody
orb1528114-01 10 µL

Rabbit SMARCD1/BAF60a Antibody

Sign In for Pricing
View Details
Rabbit SMARCD1/BAF60a Antibody
orb1528114-02 100 µL

Rabbit SMARCD1/BAF60a Antibody

Sign In for Pricing
View Details
Ethyl 6-iodo-4-oxo-4h-chromene-2-carboxylate
449521-01 100 mg

Ethyl 6-iodo-4-oxo-4h-chromene-2-carboxylate

Sign In for Pricing
View Details
Ethyl 6-iodo-4-oxo-4h-chromene-2-carboxylate
449521-02 250 mg

Ethyl 6-iodo-4-oxo-4h-chromene-2-carboxylate

Sign In for Pricing
View Details
CALM1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
14932151 3x 1.0 µg DNA

CALM1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Mouse Trpv5 Pre-designed siRNA Set A
SI115329A 1 Each

Mouse Trpv5 Pre-designed siRNA Set A

Sign In for Pricing
View Details