Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2A12 (OR2A12)

This Recombinant Human Olfactory receptor 2A12 (OR2A12) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 2A12, Olfactory receptor OR7-10

UniProt

Q8NGT7

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESNQTWITEVILLGFQVDPALELFLFGFFLLFYSLTLMGNGIILGLIYLDSRLHTPMYV FLSHLAIVDMSYASSTVPKMLANLVMHKKVISFAPCILQTFLYLAFAITECLILVMMCYD RYVAICHPLQYTLIMNWRVCTVLASTCWIFSFLLALVHITLILRLPFCGPQKINHFFCQI MSVFKLACADTRLNQVVLFAGSAFILVGPLCLVLVSYLHILVAILRIQSGEGRRKAFSTC SSHLCVVGLFFGSAIVMYMAPKSSHSQERRKILSLFYSLFNPILNPLIYSLRNAEVKGAL KRVLWKQRSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smooth Muscle Actin (ACTA2/791), CF640R conjugate, 0.1mg/mL
BNC400791-100 1x 100 µL

Smooth Muscle Actin (ACTA2/791), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(+)-(S)-Dihydrokavain
TRC-D450620-5MG 5 mg

(+)-(S)-Dihydrokavain

Sign In for Pricing
View Details
Diclofenac Sodium Salt
TRC-D436450-50MG 50 mg

Diclofenac Sodium Salt

Sign In for Pricing
View Details
Dopamine beta Hydroxylase Antibody
KC-3224-01 50 μL

Dopamine beta Hydroxylase Antibody

Sign In for Pricing
View Details
Dopamine beta Hydroxylase Antibody
KC-3224-02 100 µL

Dopamine beta Hydroxylase Antibody

Sign In for Pricing
View Details
Dopamine beta Hydroxylase Antibody
KC-3224-03 1 mL

Dopamine beta Hydroxylase Antibody

Sign In for Pricing
View Details