Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1086 (Olfr1086)

This Recombinant Mouse Olfactory receptor 1086 (Olfr1086) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 1086, Olfactory receptor 179-2

UniProt

Q8VFL9

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENITEVTEFILMGFTDNADLEILSFFLFLAIYLFTLMGNLGLITLVIGDSRLHNPMYYF LSVLSSVDACYSTVITPQMVVDFVSEKKVISFIGCATQMFLAVTFGTTECFLLAAMAYDR YVAIHNPLMYVVSMSPRVYVPLIIASYAGGILHAVIHTVATFRLSFCGSNKISHIFCDIP PLLAISCSDTHFNQLLLFYCAGFIEVVTILIVLLSYGFILSVILKTRSTEGKRKVFSTCG SHLMAVSTFHGTVLFMYVRPSDSYALEHDMMVSIFYSIVIPMLNPLIYSLRNKDVKEAIK KVFGKRILCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit F-box only protein 21 (FBXO21) ELISA Kit
MBS7247198-01 48 Well

Rabbit F-box only protein 21 (FBXO21) ELISA Kit

Sign In for Pricing
View Details
Rabbit F-box only protein 21 (FBXO21) ELISA Kit
MBS7247198-02 96 Well

Rabbit F-box only protein 21 (FBXO21) ELISA Kit

Sign In for Pricing
View Details
Rabbit F-box only protein 21 (FBXO21) ELISA Kit
MBS7247198-03 5x 96 Well

Rabbit F-box only protein 21 (FBXO21) ELISA Kit

Sign In for Pricing
View Details
Rabbit F-box only protein 21 (FBXO21) ELISA Kit
MBS7247198-04 10x 96 Well

Rabbit F-box only protein 21 (FBXO21) ELISA Kit

Sign In for Pricing
View Details
Human Hyaluronan-Binding Protein 2 ELISA Kit
MBS3804371-01 48 Well

Human Hyaluronan-Binding Protein 2 ELISA Kit

Sign In for Pricing
View Details
Human Hyaluronan-Binding Protein 2 ELISA Kit
MBS3804371-02 96 Well

Human Hyaluronan-Binding Protein 2 ELISA Kit

Sign In for Pricing
View Details