Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1086 (Olfr1086)

This Recombinant Mouse Olfactory receptor 1086 (Olfr1086) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 1086, Olfactory receptor 179-2

UniProt

Q8VFL9

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENITEVTEFILMGFTDNADLEILSFFLFLAIYLFTLMGNLGLITLVIGDSRLHNPMYYF LSVLSSVDACYSTVITPQMVVDFVSEKKVISFIGCATQMFLAVTFGTTECFLLAAMAYDR YVAIHNPLMYVVSMSPRVYVPLIIASYAGGILHAVIHTVATFRLSFCGSNKISHIFCDIP PLLAISCSDTHFNQLLLFYCAGFIEVVTILIVLLSYGFILSVILKTRSTEGKRKVFSTCG SHLMAVSTFHGTVLFMYVRPSDSYALEHDMMVSIFYSIVIPMLNPLIYSLRNKDVKEAIK KVFGKRILCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX7B AAV Vector (Human) (CMV)
16720101 1 µg

COX7B AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
KIAA1618 sgRNA CRISPR Lentivector (Human) (Target 3)
K1142704 1.0 µg DNA

KIAA1618 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SPANXN4 (NM_001009613) Human Over-expression Lysate
LY422927 100 µg

SPANXN4 (NM_001009613) Human Over-expression Lysate

Sign In for Pricing
View Details
PDS5B Polyclonal Antibody
UB-GEN-5180 100 µL

PDS5B Polyclonal Antibody

Sign In for Pricing
View Details
Oxytocin R Polyclonal Antibody, RBITC Conjugated
bs-25327R-RBITC 100 µL

Oxytocin R Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
STX17 (NM_017919) Human Tagged Lenti ORF Clone
RC210324L3 10 µg

STX17 (NM_017919) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details