Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1019 (Olfr1019)

This Recombinant Mouse Olfactory receptor 1019 (Olfr1019) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 1019, Olfactory receptor 180-1

UniProt

Q8VGS3

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKENHSVVTEFVFMGITQDPQLQIIFFVVFLLVYLVNVIGNVGMIILIITDSQLHTPMY FFLCNLSFVDLGYSSAIAPRMLADFLTKHKVISFSSCATQFAFFVGFVDAECYVLAAMAY DRFVAICRPLHYSTLMSKKVCLVLMLGSYFAGLVSLVAHTSLTFSLSYCGSNIINHFFCE IPPLLALSCSDTYISEILLFSLCGFIEFSTILIIFISYAFILIAIIRIRSAEGRLKAFST CGSHLTGVTLFYGTVMFMYLRPTSSYSLDQDKWASVFYTIIIPMLNPLIYSLRNKDVKAA FKKLIGKKPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Viral Dengue Virus 2 NS1 MAb (Clone 969828)
MAB94391-SP 25 µg

Viral Dengue Virus 2 NS1 MAb (Clone 969828)

Sign In for Pricing
View Details
Uridine diphosphate glucose
orb1706057-01 1 mg

Uridine diphosphate glucose

Sign In for Pricing
View Details
Uridine diphosphate glucose
orb1706057-02 5 mg

Uridine diphosphate glucose

Sign In for Pricing
View Details
Uridine diphosphate glucose
orb1706057-03 10 mg

Uridine diphosphate glucose

Sign In for Pricing
View Details
Uridine diphosphate glucose
orb1706057-04 25 mg

Uridine diphosphate glucose

Sign In for Pricing
View Details
Uridine diphosphate glucose
orb1706057-05 50 mg

Uridine diphosphate glucose

Sign In for Pricing
View Details