Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8B12 (OR8B12)

This Recombinant Human Olfactory receptor 8B12 (OR8B12) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 8B12, Olfactory receptor OR11-317

UniProt

Q8NGG6

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAKNSSVTEFILEGLTHQPGLRIPLFFLFLGFYTVTVVGNLGLITLIGLNSHLHTPMYF FLFNLSLIDFCFSTTITPKMLMSFVSRKNIISFTGCMTQLFFFCFFVVSESFILSAMAYD RYVAICNPLLYTVTMSCQVCLLLLLGAYGMGFAGAMAHTGSIMNLTFCADNLVNHFMCDI LPLLELSCNSSYMNELVVFIVVAVDVGMPIVTVFISYALILSSILHNSSTEGRSKAFSTC SSHIIVVSLFFGSGAFMYLKPLSILPLEQGKVSSLFYTIIVPVLNPLIYSLRNKDVKVAL RRTLGRKIFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit S100 Calcium Binding Protein B (S100B) ELISA Kit
QY-E30019 96 Tests

Rabbit S100 Calcium Binding Protein B (S100B) ELISA Kit

Sign In for Pricing
View Details
IRAKM Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-16695R-BF647 100 µL

IRAKM Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
DO11.10 T Cell Receptor (DO 11.10, DO-11.10, DO11.10.24, KJ1.26) (PE)
254021-PE 50 µL

DO11.10 T Cell Receptor (DO 11.10, DO-11.10, DO11.10.24, KJ1.26) (PE)

Sign In for Pricing
View Details
ART1 Human shRNA Plasmid Kit (Locus ID 417)
TL314641 1 Kit

ART1 Human shRNA Plasmid Kit (Locus ID 417)

Sign In for Pricing
View Details
PDE1B sgRNA CRISPR Lentivector set (Human)
K1617501 3x 1.0 µg

PDE1B sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
CEP70 CRISPRa sgRNA lentivector (set of three targets)(Human)
15914121 3x 1.0µg DNA

CEP70 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details