Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 476 (Olfr476)

This Recombinant Mouse Olfactory receptor 476 (Olfr476) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 476, Olfactory receptor 204-3

UniProt

Q8VGI4

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METQNHTTVTEFILLGLTESSTLRVILFMVFLGIYTVTLVGNFSIISLIRSCPQLHTPMY LFLSHLAFVDIGFSTSITPTMFKGFLGNRLVLSVAACIAQFCITVTFGTVECFLLAVMAY DRYVAICSPLLYSTHMSPRICFLLVGASYVGGCVNSGAFTSCLSILSFCGPNQIDHFFCD FPAVLKLSCSDVSIIGIIPSISAGSIIVITVFVIAVSYAYILITILKMRSTEGRQKAFST CTSHLTAVTLYYGTITFIYVMPKSNYSTAQNKILSVFYTVVIPMLNPLIYSLRNRDVKEA LRKAIIRIFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD86 Pre-designed siRNA Set B
SI002607B 1 Each

Human CD86 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral human PKMYT1 shRNA (UAS) - Lentiviral human PKMYT1 shRNA (UAS) plasmid
GTR15132979 1 Vial

Lentiviral human PKMYT1 shRNA (UAS) - Lentiviral human PKMYT1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Sptlc2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3886403 1.0 µg DNA

Sptlc2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
ZSWIM3 3'UTR Luciferase Stable Cell Line
TU029570 1.0 mL

ZSWIM3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
HSP90AB1, CT (HSP90AB1, HSP90B, HSPC2, HSPCB, Heat shock protein HSP 90-beta, Heat shock 84kD) (FITC) discontinued
036794-FITC 200 µL

HSP90AB1, CT (HSP90AB1, HSP90B, HSPC2, HSPCB, Heat shock protein HSP 90-beta, Heat shock 84kD) (FITC) discontinued

Sign In for Pricing
View Details
Recombinant Nephroselmis olivacea Apocytochrome f (petA)
orb2927356-01 20 µg

Recombinant Nephroselmis olivacea Apocytochrome f (petA)

Sign In for Pricing
View Details