Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 473 (Olfr473)

This Recombinant Mouse Olfactory receptor 473 (Olfr473) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 473, Olfactory receptor 204-4

UniProt

Q8VG44

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAENHTTVAELIILGLTEDPKLCIVFFVIFLGVYIVTLVGNISIITLIRISSQLHTPMY LFLSHLAFVDILYSTSVSVIMHMELLGHGLALPVAACAAQLCITVSFGSAECFLLAAMAY DRYVAICSPLLYSTLMSPRVCFLLLGMSYVGGCMNGWTFTGCLLSLSFCGPNQIDHFFCD FSPLLKLSCSDVSIIGIIPSISSGSIIVVTVFVIAVSYIYILITILNMRSTEGRHKAFST CTSHLTAVTLYYGTITFIYVMPKSNYSTEQNKVLSVFYTVVIPMLNPLIYSLRNRDVKEA LRKATVRVYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), Biotin conjugate, 0.1mg/mL
BNCB0861-100 1x 100 µL

HSP27 (G3.1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
n-Heptyl 4-hydroxybenzoate-d4
TRC-H283182-25MG 25 mg

n-Heptyl 4-hydroxybenzoate-d4

Sign In for Pricing
View Details
PKN1 (NM_002741) Human Recombinant Protein
TP307788 20 µg

PKN1 (NM_002741) Human Recombinant Protein

Sign In for Pricing
View Details
PTEN Antibody
KC-4168-01 50 μL

PTEN Antibody

Sign In for Pricing
View Details
PTEN Antibody
KC-4168-02 100 µL

PTEN Antibody

Sign In for Pricing
View Details
PTEN Antibody
KC-4168-03 1 mL

PTEN Antibody

Sign In for Pricing
View Details