Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2A7 (OR2A7)

This Recombinant Human Olfactory receptor 2A7 (OR2A7) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 2A7, Olfactory receptor OR7-18

UniProt

Q96R45

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDNITSITEFLLLGFPVGPRIQMLLFGLFSLFYVFTLLGNGTILGLISLDSRLHAPMYF FLSHLAVVDIAYACNTVPRMLVNLLHPAKPISFAGRMMQTFLFSTFAVTECLLLVVMSYD LYVAICHPLRYLAIMTWRVCITLAVTSWTTGVLLSLIHLVLLLPLPFCRPQKIYHFFCEI LAVLKLACADTHINENMVLAGAISGLVGPLSTIVVSYMCILCAILQIQSREVQRKAFCTC FSHLCVIGLFYGTAIIMYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLICSLRNSEVKNTL KRVLGVERAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Havcr2 Rat shRNA Plasmid (Locus ID 363578)
TL704181 1 Kit

Havcr2 Rat shRNA Plasmid (Locus ID 363578)

Sign In for Pricing
View Details
SCYE1 (Small Inducible Cytokine Subfamily E, Member 1 (Endothelial monocyte-Activating), AIMP1, EMAP2, EMAPII, p43) (MaxLight 750)
MBS6240469-01 0.1 mL

SCYE1 (Small Inducible Cytokine Subfamily E, Member 1 (Endothelial monocyte-Activating), AIMP1, EMAP2, EMAPII, p43) (MaxLight 750)

Sign In for Pricing
View Details
SCYE1 (Small Inducible Cytokine Subfamily E, Member 1 (Endothelial monocyte-Activating), AIMP1, EMAP2, EMAPII, p43) (MaxLight 750)
MBS6240469-02 5x 0.1 mL

SCYE1 (Small Inducible Cytokine Subfamily E, Member 1 (Endothelial monocyte-Activating), AIMP1, EMAP2, EMAPII, p43) (MaxLight 750)

Sign In for Pricing
View Details
NLRP6 Protein Vector (Human) (pPM-C-HA)
PV104580 500 ng

NLRP6 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
TRNAM4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV752899 1.0 µg DNA

TRNAM4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Goat Interleukin 16 (IL-16) ELISA Kit
201-07-1020 96 Tests

Goat Interleukin 16 (IL-16) ELISA Kit

Sign In for Pricing
View Details