Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2A7 (OR2A7)

This Recombinant Human Olfactory receptor 2A7 (OR2A7) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 2A7, Olfactory receptor OR7-18

UniProt

Q96R45

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDNITSITEFLLLGFPVGPRIQMLLFGLFSLFYVFTLLGNGTILGLISLDSRLHAPMYF FLSHLAVVDIAYACNTVPRMLVNLLHPAKPISFAGRMMQTFLFSTFAVTECLLLVVMSYD LYVAICHPLRYLAIMTWRVCITLAVTSWTTGVLLSLIHLVLLLPLPFCRPQKIYHFFCEI LAVLKLACADTHINENMVLAGAISGLVGPLSTIVVSYMCILCAILQIQSREVQRKAFCTC FSHLCVIGLFYGTAIIMYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLICSLRNSEVKNTL KRVLGVERAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLCC1 (NM_001048210) Human Recombinant Protein
PROTQ96S66 20 µg

CLCC1 (NM_001048210) Human Recombinant Protein

Sign In for Pricing
View Details
Ttr sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4660303 1.0 µg DNA

Ttr sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Anti-TOAG1 antibody
PAab08849 100 µg

Anti-TOAG1 antibody

Sign In for Pricing
View Details
NSUN6 (NM_182543) Human Recombinant Protein
TP307817 20 µg

NSUN6 (NM_182543) Human Recombinant Protein

Sign In for Pricing
View Details
IFI16 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-15548R-BF680 100 µL

IFI16 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Human MMP19 Pre-designed siRNA Set A
SI009669A 1 Each

Human MMP19 Pre-designed siRNA Set A

Sign In for Pricing
View Details