Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2A7 (OR2A7)

This Recombinant Human Olfactory receptor 2A7 (OR2A7) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 2A7, Olfactory receptor OR7-18

UniProt

Q96R45

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDNITSITEFLLLGFPVGPRIQMLLFGLFSLFYVFTLLGNGTILGLISLDSRLHAPMYF FLSHLAVVDIAYACNTVPRMLVNLLHPAKPISFAGRMMQTFLFSTFAVTECLLLVVMSYD LYVAICHPLRYLAIMTWRVCITLAVTSWTTGVLLSLIHLVLLLPLPFCRPQKIYHFFCEI LAVLKLACADTHINENMVLAGAISGLVGPLSTIVVSYMCILCAILQIQSREVQRKAFCTC FSHLCVIGLFYGTAIIMYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLICSLRNSEVKNTL KRVLGVERAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMC9 Polyclonal Antibody, FITC Conjugated
A58160-050 50 µL

ARMC9 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Recombinant Mycoplasma Pneumoniae MPN_032 Protein (aa 1-108)
VAng-Lsx04776-1mgEcoli 1 mg (E. coli)

Recombinant Mycoplasma Pneumoniae MPN_032 Protein (aa 1-108)

Sign In for Pricing
View Details
BTNL8 (NM_024850) Human Over-expression Lysate
LS079908 100 µg

BTNL8 (NM_024850) Human Over-expression Lysate

Sign In for Pricing
View Details
1700022I11Rik (NM_026088) Mouse Untagged Clone
MC223861 10 µg

1700022I11Rik (NM_026088) Mouse Untagged Clone

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. tomato Protein TolB (tolB)
MBS1440146-01 0.02 mg (E-Coli)

Recombinant Pseudomonas syringae pv. tomato Protein TolB (tolB)

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. tomato Protein TolB (tolB)
MBS1440146-02 0.02 mg (Yeast)

Recombinant Pseudomonas syringae pv. tomato Protein TolB (tolB)

Sign In for Pricing
View Details